Pfam domain
Pfam family: RNA_pol_Rpb5_C (PF01191.18)
Uniprot AC: P19388
RecName: DNA-directed RNA polymerases I, II, and III subunit RPABC1
Begin-End: 137-209
Organism: Homo sapiens
Interaction Mode:   

Sequence:
INITEHELVPEHVVMTKEEVTELLARYKLRENQLPRIQAGDPVARYFGIKRGQVVKIIRP
SETAGRYITYRLV
Structures of the domain P19388 137-209
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5iy7 X-ray 8.6 E 137-209 None
5iya X-ray 5.4 E 137-209 None
5iy8 X-ray 7.9 E 137-209 None
5iyd X-ray 3.9 E 137-209 None
5iy6 X-ray 7.2 E 137-209 None
5iyc X-ray 3.9 E 137-209 None
5iy9 X-ray 6.3 E 137-209 None
5iyb X-ray 3.9 E 137-209 None


© NPIDB team 2003 - 2019

text