Pfam domain
Pfam family: RNA_pol_Rpb5_N (PF03871.13)
Uniprot AC: P19388
RecName: DNA-directed RNA polymerases I, II, and III subunit RPABC1
Begin-End: 4-94
Organism: Homo sapiens
Interaction Mode:  H-Bb 

Sequence:
EEETYRLWKIRKTIMQLCHDRGYLVTQDELDQTLEEFKAQSGDKPSEGRPRRTDLTVLVA
HNDDPTDQMFVFFPEEPKVGIKTIKVYCQRM
Structures of the domain P19388 4-94
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5iy7 X-ray 8.6 E 4-94  H-Bb 
5iya X-ray 5.4 E 4-94 None
5iy8 X-ray 7.9 E 4-94  H-Bb 
5iyd X-ray 3.9 E 4-94 None
5iy6 X-ray 7.2 E 4-94 None
5iyc X-ray 3.9 E 4-94  H-Bb 
5iy9 X-ray 6.3 E 4-94 None
5iyb X-ray 3.9 E 4-94  H-Bb 


© NPIDB team 2003 - 2019

text