Pfam domain
Pfam family: Ets (PF00178.21)
Uniprot AC: P19419
RecName: ETS domain-containing protein Elk-1
Begin-End: 6-86
Organism: Homo sapiens
Interaction Mode:  H-Bb H-Mj L-Bb 

Sequence:
TLWQFLLQLLREQGNGHIISWTSRDGGEFKLVDAEEVARLWGLRKNKTNMNYDKLSRALR
YYYDKNIIRKVSGQKFVYKFV
Structures of the domain P19419 6-86
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
1dux X-ray 2.1 C 6-86  H-Bb H-Mj L-Bb 
1dux X-ray 2.1 F 6-86  H-Bb H-Mj L-Bb 


© NPIDB team 2003 - 2019

text