Pfam domain
Pfam family: ResIII (PF04851.14)
Uniprot AC: P19447
RecName: General transcription and DNA repair factor IIH helicase subunit XPB
Begin-End: 313-472
Organism: Homo sapiens
Interaction Mode:  L-Bb L-Mn 

Sequence:
TAVLRPYQEKSLRKMFGNGRARSGVIVLPCGAGKSLVGVTAACTVRKRCLVLGNSAVSVE
QWKAQFKMWSTIDDSQICRFTSDAKDKPIGCSVAISTYSMLGHTTKRSWEAERVMEWLKT
QEWGLMILDEVHTIPAKMFRRVLTIVQAHCKLGLTATLVR
Structures of the domain P19447 313-472
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5iy7 X-ray 8.6 V 315-470  L-Bb 
5iy8 X-ray 7.9 V 315-470  L-Bb L-Mn 
5ivw X-ray 10 V 315-470  L-Bb L-Mn 
5iy6 X-ray 7.2 V 315-470  L-Bb 
5iy9 X-ray 6.3 V 315-470  L-Mn 


© NPIDB team 2003 - 2019

text