Pfam domain
Pfam family: ERCC3_RAD25_C (PF16203.4)
Uniprot AC: P19447
RecName: General transcription and DNA repair factor IIH helicase subunit XPB
Begin-End: 496-718
Organism: Homo sapiens
Interaction Mode:  H-Bb 

Sequence:
LQNNGYIAKVQCAEVWCPMSPEFYREYVAIKTKKRILLYTMNPNKFRACQFLIKFHERRN
DKIIVFADNVFALKEYAIRLNKPYIYGPTSQGERMQILQNFKHNPKINTIFISKVGDTSF
DLPEANVLIQISSHGGSRRQEAQRLGRVLRAKKGMVAEEYNAFFYSLVSQDTQEMAYSTK
RQRFLVDQGYSFKVITKLAGMEEEDLAFSTKEEQQQLLQKVLA
Structures of the domain P19447 496-718
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5iy7 X-ray 8.6 V 496-717  H-Bb 
5iy8 X-ray 7.9 V 496-717  H-Bb 
5ivw X-ray 10 V 496-717  H-Bb 
5iy6 X-ray 7.2 V 496-717 None
5iy9 X-ray 6.3 V 496-717 None


© NPIDB team 2003 - 2019

text