Pfam domain
Pfam family: FOXP-CC (PF16159.7)
Uniprot AC: P19544
RecName: Wilms tumor protein
Begin-End: 409-438
Organism: Homo sapiens
Interaction Mode:  H-Bb H-Mj S-Bb L-Bb L-Mj 

Sequence:
TSEKPFSCRWPSCQKKFARSDELVRHHNMH
Structures of the domain P19544 409-438
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5kl5 X-ray 2.29 A 408-436  H-Bb H-Mj S-Bb L-Bb L-Mj 
4r2e X-ray 1.84 A 408-437  H-Bb H-Mj S-Bb L-Bb L-Mj 
4r2p X-ray 1.79 A 408-437  H-Bb H-Mj S-Bb L-Bb L-Mj 
4r2q X-ray 1.54 A 408-436  H-Bb H-Mj S-Bb L-Bb L-Mj 
4r2r X-ray 2.09 A 408-436  H-Bb H-Mj S-Bb L-Bb L-Mj 
4r2s X-ray 2.49 A 408-437  H-Bb H-Mj L-Mj 
5kl7 X-ray 1.58 A 408-436  H-Bb H-Mj S-Bb L-Bb L-Mj 
5kl4 X-ray 1.78 A 408-437  H-Bb H-Mj L-Bb L-Mj 
5kl4 X-ray 1.78 D 409-436  H-Bb H-Mj S-Bb L-Bb L-Mj 
5kl6 X-ray 1.64 A 408-437  H-Bb H-Mj S-Bb L-Bb L-Mj 
5kl3 X-ray 1.45 A 409-437  H-Bb H-Mj S-Bb L-Bb L-Mj 
5kl2 X-ray 1.69 A 408-437  H-Bb H-Mj L-Bb L-Mj 


© NPIDB team 2003 - 2021

text