Pfam domain
Pfam family: Hormone_recep (PF00104.32)
Uniprot AC: P19793
RecName: Retinoic acid receptor RXR-alpha
Begin-End: 257-442
Organism: Homo sapiens
Interaction Mode:   

Sequence:
NPSSPNDPVTNICQAADKQLFTLVEWAKRIPHFSELPLDDQVILLRAGWNELLIASFSHR
SIAVKDGILLATGLHVHRNSAHSAGVGAIFDRVLTELVSKMRDMQMDKTELGCLRAIVLF
NPDSKGLSNPAEVEALREKVYASLEAYCKHKYPEQPGRFAKLLLRLPALRSIGLKCLEHL
FFFKLI
Structures of the domain P19793 257-442
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
4nqa X-ray 3.1 A 257-442 None


© NPIDB team 2003 - 2021

text