Pfam domain
Pfam family: 5_3_exonuc (PF01367.19)
Uniprot AC: P19821
RecName: DNA polymerase I, thermostable
Begin-End: 174-267
Organism: Thermus aquaticus
Interaction Mode:   

Sequence:
LRPDQWADYRALTGDESDNLPGVKGIGEKTARKLLEEWGSLEALLKNLDRLKPAIREKIL
AHMDDLKLSWDLAKVRTDLPLEVDFAKRREPDRE
Structures of the domain P19821 174-267
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
1tau X-ray 3 A 175-261 None


© NPIDB team 2003 - 2019

text