Pfam domain
Pfam family: Taq-exonuc (PF09281.9)
Uniprot AC: P19821
RecName: DNA polymerase I, thermostable
Begin-End: 294-420
Organism: Thermus aquaticus
Interaction Mode:   

Sequence:
LEEAPWPPPEGAFVGFVLSRKEPMWADLLALAAARGGRVHRAPEPYKALRDLKEARGLLA
KDLSVLALREGLGLPPGDDPMLLAYLLDPSNTTPEGVARRYGGEWTEEAGERAALSERLF
ANLWGRL
Structures of the domain P19821 294-420
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
3sv4 X-ray 1.99 A 295-420 None
1qss X-ray 2.3 A 295-420 None
3py8 X-ray 1.74 A 295-420 None
4bwm X-ray 1.75 A 295-420 None
4ktq X-ray 2.5 A 295-420 None
1qsy X-ray 2.3 A 295-420 None
1qtm X-ray 2.3 A 295-420 None
3ktq X-ray 2.3 A 295-420 None
3m8r X-ray 2 A 295-420 None
4elt X-ray 2.2 A 295-420 None
3rr8 X-ray 2.4 A 295-420 None
3m8s X-ray 2.2 A 295-420 None
3oju X-ray 2 A 295-420 None
3rtv X-ray 1.9 A 295-420 None
3rr7 X-ray 1.95 A 295-420 None
3rrh X-ray 1.8 A 295-420 None
4c8n X-ray 1.88 A 295-420 None
3rrg X-ray 2.3 A 295-420 None
4dfj X-ray 1.9 A 295-420 None
4elu X-ray 1.8 A 295-420 None
4df8 X-ray 2 A 295-420 None
3t3f X-ray 1.9 A 295-420 None
3syz X-ray 1.95 A 295-420 None
4dfp X-ray 2 A 295-420 None
4dfm X-ray 1.89 A 295-420 None
4dfk X-ray 1.65 A 295-420 None
4df4 X-ray 2.2 A 295-420 None
3sv3 X-ray 2.1 A 295-420 None
3sz2 X-ray 2.15 A 295-420 None
4dlg X-ray 1.89 A 295-420 None
4elv X-ray 1.9 A 295-420 None
4cch X-ray 2.55 A 295-420 None
3lwm X-ray 2.19 A 295-420 None
4dle X-ray 2.44 A 303-420 None
4c8l X-ray 1.7 A 295-420 None
3lwl X-ray 2.25 A 295-420 None
4c8k X-ray 2.17 A 295-420 None
3po5 X-ray 2.39 A 295-420 None
5nkl X-ray 1.7 A 295-420 None
4c8o X-ray 1.75 A 295-420 None
2ktq X-ray 2.3 A 295-420 None
4n5s X-ray 1.67 A 295-420 None
4n56 X-ray 2.2 A 295-420 None
4xiu X-ray 2.5 A 295-420 None
4bwj X-ray 1.55 A 295-420 None
5szt X-ray 1.8 A 295-420 None
5e41 X-ray 1.8 A 295-420 None
5oxj X-ray 2 A 295-420 None
1tau X-ray 3 A 295-420 None
3po4 X-ray 1.8 A 295-420 None
3ojs X-ray 1.9 A 295-420 None
4c8m X-ray 1.57 A 295-420 None
5o7t X-ray 1.8 A 295-420 None


© NPIDB team 2003 - 2019

text