Pfam domain
Pfam family: DNA_pol_A (PF00476.22)
Uniprot AC: P19821
RecName: DNA polymerase I, thermostable
Begin-End: 639-772
Organism: Thermus aquaticus
Interaction Mode:  H-Bb H-Mn S-Bb L-Mn 

Sequence:
HTETASWMFGVPREAVDPLMRRAAKTINFGVLYGMSAHRLSQELAIPYEEAQAFIERYFQ
SFPKVRAWIEKTLEEGRRRGYVETLFGRRRYVPDLEARVKSVREAAERMAFNMPVQGTAA
DLMKLAMVKLFPRL
Structures of the domain P19821 639-772
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
4n56 X-ray 2.2 A 669-829  H-Bb H-Mn S-Bb L-Mn 


© NPIDB team 2003 - 2021

text