Pfam domain
Pfam family: RHD_DNA_bind (PF00554.21)
Uniprot AC: P19838
RecName: Nuclear factor NF-kappa-B p105 subunit
Begin-End: 44-242
Organism: Homo sapiens
Interaction Mode:  H-Bb H-Mj S-Mj L-Bb L-Mj 

Sequence:
LQILEQPKQRGFRFRYVCEGPSHGGLPGASSEKNKKSYPQVKICNYVGPAKVIVQLVTNG
KNIHLHAHSLVGKHCEDGICTVTAGPKDMVVGFANLGILHVTKKKVFETLEARMTEACIR
GYNPGLLVHPDLAYLQAEGGGDRQLGDREKELIRQAALQQTKEMDLSVVRLMFTAFLPDS
TGSFTRRLEPVVSDAIYDS
Structures of the domain P19838 44-242
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
1svc X-ray 2.6 P 45-243 None
2o61 X-ray 2.8 B 42-240  H-Bb H-Mj S-Mj L-Bb L-Mj 
3gut X-ray 3.59 D 342-540  H-Bb H-Mj S-Mj L-Bb L-Mj 
3gut X-ray 3.59 B 342-540  H-Bb H-Mj S-Mj L-Bb L-Mj 
3gut X-ray 3.59 H 342-540  H-Bb H-Mj S-Mj L-Bb L-Mj 
3gut X-ray 3.59 F 342-540  H-Bb H-Mj S-Mj L-Bb L-Mj 


© NPIDB team 2003 - 2019

text