Pfam domain
Pfam family: WD40 (PF00400.31)
Uniprot AC: P20053
RecName: U4/U6 small nuclear ribonucleoprotein PRP4
Begin-End: 255-293
Organism: Saccharomyces cerevisiae
Interaction Mode:   

Sequence:
LRLLGDLVGHERRISDVKYHPSGKFIGSASHDMTWRLWD
Structures of the domain P20053 255-293
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
3jcm X-ray 3.8 B 257-293 None
5gap X-ray 3.6 H 257-293 None


© NPIDB team 2003 - 2020

text