Pfam domain
Pfam family: Ribosomal_L17 (PF01196.18)
Uniprot AC: P20277
RecName: 50S ribosomal protein L17
Begin-End: 16-120
Organism: Bacillus subtilis
Interaction Mode:   

Sequence:
MLRDLTTDLIINERIETTETRAKELRSVVEKMITLGKRGDLHARRQAAAYIRNEVANEEN
NQDALQKLFSDIATRYEERQGGYTRIMKLGPRRGDGAPMAIIELV
Structures of the domain P20277 16-120
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
3j3v X-ray 13.3 N 16-120 None
3j3w X-ray 10.7 N 16-120 None


© NPIDB team 2003 - 2019

text