Pfam domain
Pfam family: Ribosomal_L3 (PF00297.21)
Uniprot AC: P20279
RecName: 50S ribosomal protein L3
Begin-End: 39-321
Organism: Haloarcula marismortui
Interaction Mode:   

Sequence:
VQGFAGYKAGMTHVVLVNDEPNSPREGMEETVPVTVIETPPMRAVALRAYEDTPYGQRPL
TEVWTDEFHSELDRTLDVPEDHDPDAAEEQIRDAHEAGDLGDLRLITHTVPDAVPSVPKK
KPDVMETRVGGGSVSDRLDHALDIVEDGGEHAMNDIFRAGEYADVAGVTKGKGTQGPVKR
WGVQKRKGKHARQGWRRRIGNLGPWNPSRVRSTVPQQGQTGYHQRTELNKRLIDIGEGDE
PTVDGGFVNYGEVDGPYTLVKGSVPGPDKRLVRFRPAVRPNDQ
Structures of the domain P20279 39-321
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
1ml5 X-ray 14 e 111-274 None


© NPIDB team 2003 - 2019

text