Pfam domain
Pfam family: zf-C4 (PF00105.17)
Uniprot AC: P20393
RecName: Nuclear receptor subfamily 1 group D member 1
Begin-End: 130-200
Organism: Homo sapiens
Interaction Mode:  H-Bb H-Mj S-Bb S-Mj L-Bb 

Sequence:
LLCKVCGDVASGFHYGVHACEGCKGFFRRSIQQNIQYKRCLKNENCSIVRINRNRCQQCR
FKKCLSVGMSR
Structures of the domain P20393 130-200
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
1ga5 X-ray 2.4 A 0-68  H-Bb H-Mj S-Bb L-Bb 
1ga5 X-ray 2.4 B 0-68  H-Bb H-Mj S-Bb L-Bb 
1ga5 X-ray 2.4 F 0-68  H-Bb H-Mj S-Bb L-Bb 
1ga5 X-ray 2.4 E 0-68  H-Bb H-Mj S-Bb L-Bb 
1hlz X-ray 2.8 B 0-68  H-Bb H-Mj S-Bb L-Bb 
1hlz X-ray 2.8 A 0-68  H-Bb H-Mj S-Bb L-Bb 
1a6y X-ray 2.3 B 100-168 None
1a6y X-ray 2.3 A 100-168  H-Bb H-Mj S-Bb S-Mj L-Bb 


© NPIDB team 2003 - 2019

text