Pfam domain
Pfam family: EIF_2_alpha (PF07541.11)
Uniprot AC: P20459
RecName: Eukaryotic translation initiation factor 2 subunit alpha
Begin-End: 126-237
Organism: Saccharomyces cerevisiae
Interaction Mode:   

Sequence:
LYKTIAWPLSRKFGHAYEAFKLSIIDETVWEGIEPPSKDVLDELKNYISKRLTPQAVKIR
ADVEVSCFSYEGIDAIKDALKSAEDMSTEQMQVKVKLVAAPLYVLTTQALDK
Structures of the domain P20459 126-237
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
3jaq X-ray 6 j 126-237 None
3j81 X-ray 4 j 126-237 None
3jap X-ray 4.9 j 125-237 None


© NPIDB team 2003 - 2019

text