Pfam domain
Pfam family: S1 (PF00575.22)
Uniprot AC: P20459
RecName: Eukaryotic translation initiation factor 2 subunit alpha
Begin-End: 13-88
Organism: Saccharomyces cerevisiae
Interaction Mode:   

Sequence:
YPEIDDIVMVNVQQIAEMGAYVKLLEYDNIEGMILLSELSRRRIRSIQKLIRVGKNDVAV
VLRVDKEKGYIDLSKR
Structures of the domain P20459 13-88
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
3jaq X-ray 6 j 14-88 None
3j81 X-ray 4 j 14-88 None
3jap X-ray 4.9 j 13-87 None


© NPIDB team 2003 - 2019

text