Pfam domain
Pfam family: UDG (PF03167.21)
Uniprot AC: P20536
RecName: Uracil-DNA glycosylase
Begin-End: 57-208
Organism: Vaccinia virus
Interaction Mode:  H-Mn L-Bb L-Mj L-Mn 

Sequence:
LRNKRVCVCGIDPYPKDGTGVPFESPNFTKKSIKEIASSISRLTGVIDYKGYNLNIIDGV
IPWNYYLSCKLGETKSHAIYWDKISKLLLQHITKHVSVLYCLGKTDFSNIRAKLESPVTT
IVGYHPAARDRQFEKDRSFEIINVLLELDNKV
Structures of the domain P20536 57-208
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
4yig X-ray 2.7 I 54-205  L-Bb L-Mj L-Mn 
4yig X-ray 2.7 E 54-205  L-Bb L-Mj L-Mn 
4yig X-ray 2.7 A 54-205  H-Mn L-Bb L-Mj L-Mn 


© NPIDB team 2003 - 2021

text