Pfam domain
Pfam family: MutS_III (PF05192.17)
Uniprot AC: P20585
RecName: DNA mismatch repair protein Msh3
Begin-End: 540-838
Organism: Homo sapiens
Interaction Mode:  S-Bb L-Bb 

Sequence:
TTLRNLEILQNQTDMKTKGSLLWVLDHTKTSFGRRKLKKWVTQPLLKLREINARLDAVSE
VLHSESSVFGQIENHLRKLPDIERGLCSIYHKKCSTQEFFLIVKTLYHLKSEFQAIIPAV
NSHIQSDLLRTVILEIPELLSPVEHYLKILNEQAAKVGDKTELFKDLSDFPLIKKRKDEI
QGVIDEIRMHLQEIRKILKNPSAQYVTVSGQEFMIEIKNSAVSCIPTDWVKVGSTKAVSR
FHSPFIVENYRHLNQLREQLVLDCSAEWLDFLEKFSEHYHSLCKAVHHLATVDCIFSLA
Structures of the domain P20585 540-838
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
3thy X-ray 2.89 B 531-829  S-Bb L-Bb 
3thx X-ray 2.7 B 531-829  S-Bb L-Bb 
3thz X-ray 4.3 B 531-829  L-Bb 
3thw X-ray 3.09 B 531-829  S-Bb L-Bb 


© NPIDB team 2003 - 2019

text