Pfam domain
Pfam family: MutS_V (PF00488.23)
Uniprot AC: P20585
RecName: DNA mismatch repair protein Msh3
Begin-End: 892-1094
Organism: Homo sapiens
Interaction Mode:   

Sequence:
MIITGPNMGGKSSYIKQVALITIMAQIGSYVPAEEATIGIVDGIFTRMGAADNIYKGQST
FMEELTDTAEIIRKATSQSLVILDELGRGTSTHDGIAIAYATLEYFIRDVKSLTLFVTHY
PPVCELEKNYSHQVGNYHMGFLVSEDESKLDPGAAEQVPDFVTFLYQITRGIAARSYGLN
VAKLADVPGEILKKAAHKSKELE
Structures of the domain P20585 892-1094
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
3thz X-ray 4.3 B 883-1085 None
3thw X-ray 3.09 B 883-1085 None
3thx X-ray 2.7 B 883-1085 None
3thy X-ray 2.89 B 883-1085 None


© NPIDB team 2003 - 2021

text