Pfam domain
Pfam family: Histone (PF00125.23)
Uniprot AC: P20671
RecName: Histone H2A type 1-D
Begin-End: 17-91
Organism: Homo sapiens
Interaction Mode:  H-Bb S-Bb L-Bb 

Sequence:
TRSSRAGLQFPVGRVHRLLRKGNYSERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKK
TRIIPRHLQLAIRND
Structures of the domain P20671 17-91
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5gt3 X-ray 2.91 G 19-88  H-Bb S-Bb L-Bb 
5gt3 X-ray 2.91 C 17-88  H-Bb S-Bb L-Bb 


© NPIDB team 2003 - 2019

text