Pfam domain
Pfam family: Homeodomain (PF00046.31)
Uniprot AC: P20823
RecName: Hepatocyte nuclear factor 1-alpha
Begin-End: 180-255
Organism: Homo sapiens
Interaction Mode:  H-Bb H-Mj L-Bb L-Mn 

Sequence:
AGQGGLIEEPTGDELPTKKGRRNRFKWGPASQQILFQAYERQKNPSKEERETLVEECNRA
ECIQRGVSPSQAQGLG
Structures of the domain P20823 180-255
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
1ic8 X-ray 2.6 B 179-275  H-Bb H-Mj L-Bb L-Mn 
1ic8 X-ray 2.6 A 180-275  H-Bb H-Mj L-Bb 


© NPIDB team 2003 - 2021

text