Pfam domain
Pfam family: HNF-1_N (PF04814.15)
Uniprot AC: P20823
RecName: Hepatocyte nuclear factor 1-alpha
Begin-End: 85-168
Organism: Homo sapiens
Interaction Mode:  H-Bb H-Mj L-Bb L-Mj 

Sequence:
ILKELENLSPEEAAHQKAVVETLLQEDPWRVAKMVKSYLQQHNIPQREVVDTTGLNQSHL
SQHLNKGTPMKTQKRAALYTWYVR
Structures of the domain P20823 85-168
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
1ic8 X-ray 2.6 B 85-168  H-Bb H-Mj L-Bb L-Mj 
1ic8 X-ray 2.6 A 87-168  H-Bb H-Mj L-Bb L-Mj 


© NPIDB team 2003 - 2021

text