Pfam domain
Pfam family: DNA_pol_B_exo1 (PF03104.18)
Uniprot AC: P21189
RecName: DNA polymerase II
Begin-End: 63-168
Organism: Escherichia coli
Interaction Mode:   

Sequence:
FRLTPLALKDFHRQPVYGLYCRAHRQLMNYEKRLREGGVTVYEADVRPPERYLMERFITS
PVWVEGDMHNGTIVNARLKPHPDYRPPLKWVSIDIETTRHGELYCI
Structures of the domain P21189 63-168
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
3k58 X-ray 2.05 A 74-164 None
3maq X-ray 2.4 A 74-164 None
3k5l X-ray 2.7 A 74-164 None
3k5n X-ray 3.15 A 74-164 None
3k5n X-ray 3.15 B 74-164 None
3k57 X-ray 2.08 A 74-164 None
3k5m X-ray 2.04 A 74-164 None
3k59 X-ray 1.92 A 74-164 None


© NPIDB team 2003 - 2019

text