Pfam domain
Pfam family: LAGLIDADG_3 (PF14528.5)
Uniprot AC: P21505
RecName: Homing endonuclease I-DmoI
Begin-End: 104-178
Organism: Desulfurococcus mobilis
Interaction Mode:  H-Bb H-Mj S-Bb S-Mj L-Bb L-Mj 

Sequence:
REQIAFIKGLYVAEGDKTLKRLRIWNKNKALLEIVSRWLNNLGVRNTIHLDDHRHGVYVL
NISLRDRIKFVHTIL
Structures of the domain P21505 104-178
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5o6g X-ray 2.75 A 108-177  H-Bb H-Mj S-Bb S-Mj L-Bb L-Mj 
5o6g X-ray 2.75 D 108-177  H-Bb H-Mj S-Bb S-Mj L-Bb L-Mj 
5o6g X-ray 2.75 G 108-177  H-Bb H-Mj S-Bb S-Mj L-Bb L-Mj 
2vs8 X-ray 2.1 K 108-177  H-Bb H-Mj S-Bb S-Mj L-Bb L-Mj 
2vs8 X-ray 2.1 A 108-177 None
2vs8 X-ray 2.1 F 108-177 None
2vs7 X-ray 2.05 G 108-177  H-Bb H-Mj S-Bb S-Mj L-Bb L-Mj 
2vs7 X-ray 2.05 D 108-177  H-Bb H-Mj S-Bb S-Mj L-Bb L-Mj 
2vs7 X-ray 2.05 A 108-177  H-Bb H-Mj S-Bb S-Mj L-Bb L-Mj 
4unb X-ray 2.55 D 108-177  H-Bb H-Mj S-Bb S-Mj L-Bb L-Mj 
4unb X-ray 2.55 A 108-177 None
4unb X-ray 2.55 G 108-177 None
5akf X-ray 2.45 I 108-177  H-Bb H-Mj S-Bb S-Mj L-Bb L-Mj 
5akf X-ray 2.45 E 108-177  H-Bb H-Mj S-Bb S-Mj L-Bb L-Mj 
5akf X-ray 2.45 A 108-177  H-Bb H-Mj S-Bb S-Mj L-Bb L-Mj 
4unc X-ray 2.3 G 108-177  H-Bb H-Mj S-Bb S-Mj L-Bb L-Mj 
4unc X-ray 2.3 D 108-177 None
4unc X-ray 2.3 A 108-177 None
4ut0 X-ray 2.4 A 108-177  H-Bb H-Mj S-Bb S-Mj L-Bb L-Mj 
4ut0 X-ray 2.4 K 108-177 None
4ut0 X-ray 2.4 F 108-177 None
4un8 X-ray 2.6 A 108-177  H-Bb H-Mj S-Bb S-Mj L-Bb L-Mj 
4un8 X-ray 2.6 G 108-177 None
4un8 X-ray 2.6 D 108-177 None
4un7 X-ray 2.7 G 108-177  H-Bb H-Mj S-Bb S-Mj L-Bb L-Mj 
4un7 X-ray 2.7 D 108-177 None
4un7 X-ray 2.7 A 108-177 None
4una X-ray 2.3 D 108-177  H-Bb H-Mj S-Bb S-Mj L-Bb L-Mj 
4una X-ray 2.3 A 108-177 None
4una X-ray 2.3 G 108-177 None
5akn X-ray 2.75 A 108-177  H-Bb H-Mj S-Bb S-Mj L-Bb L-Mj 
5akn X-ray 2.75 K 108-177 None
5akn X-ray 2.75 F 108-177 None
4un9 X-ray 2.73 A 108-177  H-Bb H-Mj S-Bb S-Mj L-Bb L-Mj 
4un9 X-ray 2.73 D 108-177 None
4un9 X-ray 2.73 G 108-177 None
4d6o X-ray 2.2 D 108-177  H-Bb H-Mj S-Bb S-Mj L-Bb L-Mj 
4d6o X-ray 2.2 G 108-177  H-Bb H-Mj S-Bb S-Mj L-Bb L-Mj 
4d6o X-ray 2.2 A 108-177  H-Bb H-Mj S-Bb S-Mj L-Bb L-Mj 
5a0w X-ray 2.2 D 108-177  H-Bb H-Mj S-Bb S-Mj L-Bb L-Mj 
5a0w X-ray 2.2 A 108-177  H-Bb H-Mj S-Bb S-Mj L-Bb L-Mj 
5a0w X-ray 2.2 G 108-177  H-Bb H-Mj S-Bb S-Mj L-Bb L-Mj 
5ak9 X-ray 2.6 A 108-177  H-Bb H-Mj S-Bb S-Mj L-Bb L-Mj 
5ak9 X-ray 2.6 J 108-177  H-Bb H-Mj S-Bb S-Mj L-Bb L-Mj 
5ak9 X-ray 2.6 E 108-177  H-Bb H-Mj S-Bb S-Mj L-Bb L-Mj 
5akm X-ray 2.4 F 108-177 None
5akm X-ray 2.4 K 108-177  H-Bb H-Mj S-Bb S-Mj L-Bb L-Mj 
5akm X-ray 2.4 A 108-177 None
4d6n X-ray 2.35 K 108-177  H-Bb H-Mj S-Bb S-Mj L-Bb L-Mj 
4d6n X-ray 2.35 F 108-177  H-Bb H-Mj S-Bb S-Mj L-Bb L-Mj 
4d6n X-ray 2.35 A 108-177  H-Bb H-Mj S-Bb S-Mj L-Bb L-Mj 
5o6i X-ray 2.25 A 108-177  H-Bb H-Mj S-Bb S-Mj L-Bb L-Mj 
5o6i X-ray 2.25 F 108-177  H-Bb H-Mj S-Bb S-Mj L-Bb L-Mj 
5o6i X-ray 2.25 K 108-177  H-Bb H-Mj S-Bb S-Mj L-Bb L-Mj 


© NPIDB team 2003 - 2019

text