Pfam domain
Pfam family: LAGLIDADG_3 (PF14528.5)
Uniprot AC: P21505
RecName: Homing endonuclease I-DmoI
Begin-End: 8-96
Organism: Desulfurococcus mobilis
Interaction Mode:  H-Bb S-Bb S-Mj L-Bb L-Mj 

Sequence:
SGISAYLLGLIIGDGGLYKLKYKGNRSEYRVVITQKSENLIKQHIAPLMQFLIDELNVKS
KIQIVKGDTRYELRVSSKKLYYYFANMLE
Structures of the domain P21505 8-96
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5o6g X-ray 2.75 A 12-93  H-Bb S-Bb S-Mj L-Bb L-Mj 
5o6g X-ray 2.75 D 12-93  H-Bb S-Bb S-Mj L-Bb L-Mj 
5o6g X-ray 2.75 G 12-93  H-Bb S-Bb S-Mj L-Bb L-Mj 
2vs8 X-ray 2.1 K 12-92  H-Bb S-Bb S-Mj L-Bb 
2vs8 X-ray 2.1 A 12-92 None
2vs8 X-ray 2.1 F 12-92 None
2vs7 X-ray 2.05 G 12-92  H-Bb S-Bb S-Mj L-Bb L-Mj 
2vs7 X-ray 2.05 D 12-92  H-Bb S-Bb S-Mj L-Bb L-Mj 
2vs7 X-ray 2.05 A 12-92  H-Bb S-Bb S-Mj L-Bb L-Mj 
1mow X-ray 2.4 D 512-592  H-Bb S-Bb S-Mj L-Bb L-Mj 
1mow X-ray 2.4 A 12-92  H-Bb S-Bb S-Mj L-Bb L-Mj 
1mow X-ray 2.4 G 1012-1092  H-Bb S-Bb S-Mj L-Bb L-Mj 
4unb X-ray 2.55 D 12-92  H-Bb S-Bb S-Mj L-Bb 
4unb X-ray 2.55 A 12-92 None
4unb X-ray 2.55 G 12-92 None
5akf X-ray 2.45 I 12-92  H-Bb S-Bb S-Mj L-Bb L-Mj 
5akf X-ray 2.45 E 12-92  H-Bb S-Bb S-Mj L-Bb L-Mj 
5akf X-ray 2.45 A 12-92  H-Bb S-Bb S-Mj L-Bb L-Mj 
4unc X-ray 2.3 G 12-92  H-Bb S-Bb S-Mj L-Bb 
4unc X-ray 2.3 D 12-92 None
4unc X-ray 2.3 A 12-92 None
4ut0 X-ray 2.4 A 12-92  H-Bb S-Bb S-Mj L-Bb L-Mj 
4ut0 X-ray 2.4 K 12-92 None
4ut0 X-ray 2.4 F 12-92 None
4un8 X-ray 2.6 A 12-92  H-Bb S-Bb S-Mj L-Bb L-Mj 
4un8 X-ray 2.6 G 12-92 None
4un8 X-ray 2.6 D 12-92 None
4un7 X-ray 2.7 G 12-92  H-Bb S-Bb S-Mj L-Bb L-Mj 
4un7 X-ray 2.7 D 12-92 None
4un7 X-ray 2.7 A 12-92 None
4una X-ray 2.3 D 12-92  H-Bb S-Bb S-Mj L-Bb L-Mj 
4una X-ray 2.3 A 12-92 None
4una X-ray 2.3 G 12-92 None
5akn X-ray 2.75 A 12-92  H-Bb S-Bb S-Mj L-Bb L-Mj 
5akn X-ray 2.75 K 12-92 None
5akn X-ray 2.75 F 12-92 None
4un9 X-ray 2.73 A 12-92  H-Bb S-Bb S-Mj L-Bb L-Mj 
4un9 X-ray 2.73 D 12-92 None
4un9 X-ray 2.73 G 12-92 None
4d6o X-ray 2.2 D 12-92  H-Bb S-Bb S-Mj L-Bb L-Mj 
4d6o X-ray 2.2 G 12-92  H-Bb S-Bb S-Mj L-Bb L-Mj 
4d6o X-ray 2.2 A 12-92  H-Bb S-Bb S-Mj L-Bb L-Mj 
5a0w X-ray 2.2 D 12-92  H-Bb S-Bb S-Mj L-Bb L-Mj 
5a0w X-ray 2.2 A 12-92  H-Bb S-Bb S-Mj L-Bb L-Mj 
5a0w X-ray 2.2 G 12-92  H-Bb S-Bb S-Mj L-Bb L-Mj 
5ak9 X-ray 2.6 A 12-92  H-Bb S-Bb S-Mj L-Bb L-Mj 
5ak9 X-ray 2.6 J 12-92  H-Bb S-Bb S-Mj L-Bb L-Mj 
5ak9 X-ray 2.6 E 12-92  H-Bb S-Bb S-Mj L-Bb L-Mj 
5akm X-ray 2.4 F 12-92  H-Bb S-Bb S-Mj L-Bb L-Mj 
5akm X-ray 2.4 K 12-92  H-Bb S-Bb S-Mj L-Bb L-Mj 
5akm X-ray 2.4 A 12-92  H-Bb S-Bb S-Mj L-Bb L-Mj 
4d6n X-ray 2.35 K 12-92  H-Bb S-Bb S-Mj L-Bb 
4d6n X-ray 2.35 F 12-92  H-Bb S-Bb S-Mj L-Bb L-Mj 
4d6n X-ray 2.35 A 12-92  H-Bb S-Bb S-Mj L-Bb L-Mj 
5o6i X-ray 2.25 A 12-92  H-Bb S-Bb S-Mj L-Bb L-Mj 
5o6i X-ray 2.25 F 12-92  H-Bb S-Bb S-Mj L-Bb L-Mj 
5o6i X-ray 2.25 K 12-92  H-Bb S-Bb S-Mj L-Bb L-Mj 


© NPIDB team 2003 - 2019

text