Pfam domain
Pfam family: DUF3591 (PF12157.7)
Uniprot AC: P21675
RecName: Transcription initiation factor TFIID subunit 1
Begin-End: 588-971
Organism: Homo sapiens
Interaction Mode:  H-Bb H-Mj L-Bb L-Mn 

Sequence:
IIQHSIPAVELRQPFFPTHMGPIKLRQFHRPPLKKYSFGALSQPGPHSVQPLLKHIKKKA
KMREQERQASGGGEMFFMRTPQDLTGKDGDLILAEYSEENGPLMMQVGMATKIKNYYKRK
PGKDPGAPDCKYGETVYCHTSPFLGSLHPGQLLQAFENNLFRAPIYLHKMPETDFLIIRT
RQGYYIRELVDIFVVGQQCPLFEVPGPNSKRANTHIRDFLQVFIYRLFWKSKDRPRRIRM
EDIKKAFPSHSESSIRKRLKLCADFKRTGMDSNWWVLKSDFRLPTEEEIRAMVSPEQCCA
YYSMIAAEQRLKDAGYGEKSFFAPEEENEEDFQMKIDDEVRTAPWNTTRAFIAAMKGKCL
LEVTGVADPTGCGEGFSYVKIPNK
Structures of the domain P21675 588-971
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5fur X-ray 8.5 G 610-1086  H-Bb H-Mj L-Bb L-Mn 


© NPIDB team 2003 - 2020

text