Pfam domain
Pfam family: RAG2 (PF03089.16)
Uniprot AC: P21784
RecName: V(D)J recombination-activating protein 2
Begin-End: 51-351
Organism: Mus musculus
Interaction Mode:   

Sequence:
KQNHLKLKPAIFSKDSCYLPPLRYPATCSYKGSIDSDKHQYIIHGGKTPNNELSDKIYIM
SVACKNNKKVTFRCTEKDLVGDVPEPRYGHSIDVVYSRGKSMGVLFGGRSYMPSTQRTTE
KWNSVADCLPHVFLIDFEFGCATSYILPELQDGLSFHVSIARNDTVYILGGHSLASNIRP
ANLYRIRVDLPLGTPAVNCTVLPGGISVSSAILTQTNNDEFVIVGGYQLENQKRMVCSLV
SLGDNTIEISEMETPDWTSDIKHSKIWFGSNMGNGTIFLGIPGDNKQAMSEAFYFYTLRC
S
Structures of the domain P21784 51-351
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5zdz X-ray 2.8 D 51-351 None
5zdz X-ray 2.8 B 51-350 None
5ze0 X-ray 2.75 D 51-351 None
5ze0 X-ray 2.75 B 51-350 None
5ze2 X-ray 3.3 D 51-351  S-Bb 
5ze2 X-ray 3.3 B 51-350 None
6cik X-ray 3.15 D 51-351 None
6cik X-ray 3.15 B 51-350 None
6oep X-ray 3.7 D 51-351 None
6oep X-ray 3.7 B 51-351  S-Bb 
5ze1 X-ray 3 D 51-351 None
5ze1 X-ray 3 B 51-350 None
6oem X-ray 3.6 D 51-351 None
6oem X-ray 3.6 B 51-351  S-Bb 
6oeo X-ray 3.69 B 51-351  S-Bb 
6oeo X-ray 3.69 D 51-351  S-Bb 
6xny X-ray 2.9 D 51-351 None
6xny X-ray 2.9 B 51-350 None
6v0v X-ray 3.61 B 51-351  S-Bb 
6oeq X-ray 4.3 D 51-351  S-Bb 
6oeq X-ray 4.3 B 51-351 None
6oet X-ray 3.4 D 51-351 None
6oet X-ray 3.4 B 51-350 None
6cil X-ray 4.15 D 51-349 None
6cil X-ray 4.15 B 51-350 None
6cg0 X-ray 3.17 D 51-351 None
6cg0 X-ray 3.17 B 51-351  S-Bb 
6oer X-ray 3.29 D 51-351  L-Bb 
6oer X-ray 3.29 B 51-351 None
6cim X-ray 3.6 D 51-351 None
6cim X-ray 3.6 B 51-350 None
6oen X-ray 4.3 D 51-351 None
6oen X-ray 4.3 B 51-351 None
6cij X-ray 3.9 B 51-351  S-Bb 
6cij X-ray 3.9 D 51-351  S-Bb 
6oes X-ray 3.06 D 51-351 None
6oes X-ray 3.06 B 51-350 None
6xnx X-ray 2.7 D 51-351  S-Bb L-Bb 
6xnx X-ray 2.7 B 51-350  L-Bb 
6xnz X-ray 3.8 B 51-350  S-Bb L-Bb L-Mj 
6xnz X-ray 3.8 D 51-351  L-Bb L-Mj 


© NPIDB team 2003 - 2021

text