Pfam domain
Pfam family: Trans_reg_C (PF00486.27)
Uniprot AC: P21866
RecName: KDP operon transcriptional regulatory protein KdpE
Begin-End: 146-223
Organism: Escherichia coli
Interaction Mode:  H-Bb H-Mj S-Bb L-Bb 

Sequence:
GEEEVHLTPIEFRLLAVLLNNAGKVLTQRQLLNQVWGPNAVEHSHYLRIYMGHLRQKLEQ
DPARPRHFITETGIGYRF
Structures of the domain P21866 146-223
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
4kny X-ray 2.94 B 148-223  H-Bb H-Mj S-Bb L-Bb 
4kny X-ray 2.94 A 148-223  H-Bb H-Mj S-Bb L-Bb 
4kfc X-ray 2.53 B 148-223  H-Bb H-Mj L-Bb 
4kfc X-ray 2.53 A 148-223  H-Bb H-Mj S-Bb L-Bb 


© NPIDB team 2003 - 2020

text