Pfam domain
Pfam family: Response_reg (PF00072.23)
Uniprot AC: P21866
RecName: KDP operon transcriptional regulatory protein KdpE
Begin-End: 4-113
Organism: Escherichia coli
Interaction Mode:   

Sequence:
VLIVEDEQAIRRFLRTALEGDGMRVFEAETLQRGLLEAATRKPDLIILDLGLPDGDGIEF
IRDLRQWSAVPVIVLSARSEESDKIAALDAGADDYLSKPFGIGELQARLR
Structures of the domain P21866 4-113
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
4kny X-ray 2.94 A 4-112 None
4kny X-ray 2.94 B 4-112 None
4kfc X-ray 2.53 B 4-112 None
4kfc X-ray 2.53 A 4-112 None


© NPIDB team 2003 - 2019

text