Pfam domain
Pfam family: tRNA_anti-codon (PF01336.27)
Uniprot AC: P21889
RecName: Aspartate--tRNA ligase
Begin-End: 18-102
Organism: Escherichia coli
Interaction Mode:   

Sequence:
VTLCGWVNRRRDLGSLIFIDMRDREGIVQVFFDPDRADALKLASELRNEFCIQVTGTVRA
RDEKNINRDMATGEIEVLASSLTII
Structures of the domain P21889 18-102
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
1c0a X-ray 2.4 A 18-102 None
1il2 X-ray 2.6 A 18-102 None
1il2 X-ray 2.6 B 1018-1102 None


© NPIDB team 2003 - 2021

text