Pfam domain
Pfam family: DNA_pol_B_exo1 (PF03104.18)
Uniprot AC: P21951
RecName: DNA polymerase epsilon catalytic subunit A
Begin-End: 121-442
Organism: Saccharomyces cerevisiae
Interaction Mode:  H-Bb 

Sequence:
FLDEEGGSFKSTVVYDPYFFIACNDESRVNDVEELVKKYLESCLKSLQIIRKEDLTMDNH
LLGLQKTLIKLSFVNSNQLFEARKLLRPILQDNANNNVQRNIYNVAANGSEKVDAKHLIE
DIREYDVPYHVRVSIDKDIRVGKWYKVTQQGFIEDTRKIAFADPVVMAFDIETTKPPLKF
PDSAVDQIMMISYMIDGEGFLITNREIISEDIEDFEYTPKPEYPGFFTIFNENDEVALLQ
RFFEHIRDVRPTVISTFNGDFFDWPFIHNRSKIHGLDMFDEIGFAPDAEGEYKSSYCSHM
DCFRWVKRDSYLPQGSQGLKAV
Structures of the domain P21951 121-442
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
4ptf X-ray 2.81 A 123-442  H-Bb 
4m8o X-ray 2.2 A 123-442 None


© NPIDB team 2003 - 2020

text