Pfam domain
Pfam family: Pou (PF00157.16)
Uniprot AC: P21952
RecName: POU domain, class 3, transcription factor 1
Begin-End: 248-319
Organism: Mus musculus
Interaction Mode:  H-Bb H-Mj S-Bb L-Bb L-Mj 

Sequence:
PSSDDLEQFAKQFKQRRIKLGFTQADVGLALGTLYGNVFSQTTICRFEALQLSFKNMCKL
KPLLNKWLEETD
Structures of the domain P21952 248-319
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
2xsd X-ray 2.05 C 250-319  H-Bb H-Mj S-Bb L-Bb L-Mj 


© NPIDB team 2003 - 2020

text