Pfam domain
Pfam family: Homeobox (PF00046.28)
Uniprot AC: P21952
RecName: POU domain, class 3, transcription factor 1
Begin-End: 343-394
Organism: Mus musculus
Interaction Mode:  H-Bb H-Mj L-Bb 

Sequence:
SIEVGVKGALESHFLKCPKPSAHEITGLADSLQLEKEVVRVWFCNRRQKEKR
Structures of the domain P21952 343-394
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
2xsd X-ray 2.05 C 351-394  H-Bb H-Mj L-Bb 


© NPIDB team 2003 - 2020

text