Pfam domain
Pfam family: Helicase_C (PF00271.30)
Uniprot AC: P22082
RecName: Transcription regulatory protein SNF2
Begin-End: 1087-1201
Organism: Saccharomyces cerevisiae
Interaction Mode:  H-Bb L-Bb 

Sequence:
GKFELLDRILPKLKATGHRVLIFFQMTQIMDIMEDFLRYINIKYLRLDGHTKSDERSELL
RLFNAPDSEYLCFILSTRAGGLGLNLQTADTVIIFDTDWNPHQDLQAQDRAHRIG
Structures of the domain P22082 1087-1201
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5x0x X-ray 3.97 O 1088-1201 None
5x0y X-ray 4.69 O 1088-1201  H-Bb L-Bb 


© NPIDB team 2003 - 2019

text