Pfam domain
Pfam family: SNF2-rel_dom (PF00176.25)
Uniprot AC: P22082
RecName: Transcription regulatory protein SNF2
Begin-End: 770-1065
Organism: Saccharomyces cerevisiae
Interaction Mode:   

Sequence:
YQIKGLQWMVSLFNNHLNGILADEMGLGKTIQTISLLTYLYEMKNIRGPYLVIVPLSTLS
NWSSEFAKWAPTLRTISFKGSPNERKAKQAKIRAGEFDVVLTTFEYIIKERALLSKVKWV
HMIIDEGHRMKNAQSKLSLTLNTHYHADYRLILTGTPLQNNLPELWALLNFVLPKIFNSV
KSFDEWFNTPFANTGGQDKIELSEEETLLVIRRLHKVLRPFLLRRLKKDVEKELPDKVEK
VVKCKMSALQQIMYQQMLKYRRLFIGDQNNKKMVGLRGFNNQIMQLKKICNHPFVF
Structures of the domain P22082 770-1065
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5z3u X-ray 4.31 O 770-1065  H-Bb L-Bb 
5z3o X-ray 3.62 O 770-1065  H-Bb L-Bb 
6iy3 X-ray 3.67 O 770-1065  H-Bb H-Mn L-Bb L-Mn 
6iy2 X-ray 3.47 O 770-1065  H-Bb H-Mn L-Bb 
6uxw X-ray 8.96 A 770-1065  H-Bb L-Bb 
5x0y X-ray 4.69 O 770-1065  H-Bb L-Bb 
5x0x X-ray 3.97 O 770-1065  H-Bb 
5z3v X-ray 4.22 O 770-1065  H-Bb L-Bb 
5z3l X-ray 4.31 O 770-1065  H-Bb L-Bb L-Mn 


© NPIDB team 2003 - 2021

text