Pfam domain
Pfam family: HSF_DNA-bind (PF00447.16)
Uniprot AC: P22121
RecName: Heat shock factor protein
Begin-End: 197-280
Organism: Kluyveromyces lactis
Interaction Mode:  H-Bb H-Mj S-Bb L-Bb 

Sequence:
FVNKLWSMVNDKSNEKFIHWSTSGESIVVPNRERFVQEVLPKYFKHSNFASFVRQLNMYG
WHKVQDVKSGSMLSNNDSRWEFEN
Structures of the domain P22121 197-280
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
1fym X-ray 2.2 B 197-279  H-Bb 
1fym X-ray 2.2 A 5-281 None
3hts X-ray 1.75 B 197-281  H-Bb H-Mj S-Bb L-Bb 
1fyl X-ray 2.1 B 197-274  H-Bb 
1fyl X-ray 2.1 A 4-281 None


© NPIDB team 2003 - 2020

text