Pfam domain
Pfam family: RNA_pol_Rpb2_7 (PF04560.19)
Uniprot AC: P22138
RecName: DNA-directed RNA polymerase I subunit RPA135
Begin-End: 1067-1196
Organism: Saccharomyces cerevisiae
Interaction Mode:   

Sequence:
GGIRVGEMERDALIGHGTSFLLQDRLLNSSDYTQASVCRECGSILTTQQSVPRIGSISTV
CCRRCSMRFEDAKKLLTKSEDGEKIFIDDSQIWEDGQGNKFVGGNETTTVAIPFVLKYLD
SELSAMGIRL
Structures of the domain P22138 1067-1196
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5w65 X-ray 4.3 B 1067-1131 None
5w5y X-ray 3.8 B 1067-1131 None
5w66 X-ray 3.9 B 1067-1131 None
5w64 X-ray 4.2 B 1067-1131 None


© NPIDB team 2003 - 2019

text