Pfam domain
Pfam family: RNA_pol_Rpb2_7 (PF04560.19)
Uniprot AC: P22138
RecName: DNA-directed RNA polymerase I subunit RPA135
Begin-End: 1067-1201
Organism: Saccharomyces cerevisiae
Interaction Mode:   

Sequence:
GGIRVGEMERDALIGHGTSFLLQDRLLNSSDYTQASVCRECGSILTTQQSVPRIGSISTV
CCRRCSMRFEDAKKLLTKSEDGEKIFIDDSQIWEDGQGNKFVGGNETTTVAIPFVLKYLD
SELSAMGIRLRYNVE
Structures of the domain P22138 1067-1201
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5m5x X-ray 4 B 1067-1198 None
5m5y X-ray 4 B 1067-1198 None
5oa1 X-ray 4.4 B 1067-1198 None
5m3f X-ray 3.8 B 1067-1198 None


© NPIDB team 2003 - 2019

text