Pfam domain
Pfam family: RNA_pol_Rpb2_2 (PF04561.13)
Uniprot AC: P22138
RecName: DNA-directed RNA polymerase I subunit RPA135
Begin-End: 210-403
Organism: Saccharomyces cerevisiae
Interaction Mode:   

Sequence:
RRNHPMAIIRPSFANRGASYSHYGIQIRSVRPDQTSQTNVLHYLNDGQVTFRFSWRKNEY
LVPVVMILKALCHTSDREIFDGIIGNDVKDSFLTDRLELLLRGFKKRYPHLQNRTQVLQY
LGDKFRVVFQASPDQSDLEVGQEVLDRIVLVHLGKDGSQDKFRMLLFMIRKLYSLVAGEC
SPDNPDATQHQEVL
Structures of the domain P22138 210-403
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5w65 X-ray 4.3 B 210-402 None
5w5y X-ray 3.8 B 210-402 None
5w66 X-ray 3.9 B 210-402 None
5m5x X-ray 4 B 210-402 None
5m5y X-ray 4 B 210-402 None
5w64 X-ray 4.2 B 210-402 None
5oa1 X-ray 4.4 B 210-402 None
5m3f X-ray 3.8 B 210-402 None


© NPIDB team 2003 - 2019

text