Pfam domain
Pfam family: RNA_pol_Rpb2_6 (PF00562.27)
Uniprot AC: P22138
RecName: DNA-directed RNA polymerase I subunit RPA135
Begin-End: 700-1065
Organism: Saccharomyces cerevisiae
Interaction Mode:  L-Bb 

Sequence:
LANLTPFSDFNQSPRNMYQCQMGKQTMGTPGVALCHRSDNKLYRLQTGQTPIVKANLYDD
YGMDNFPNGFNAVVAVISYTGYDMDDAMIINKSADERGFGYGTMYKTEKVDLALNRNRGD
PITQHFGFGNDEWPKEWLEKLDEDGLPYIGTYVEEGDPICAYFDDTLNKTKIKTYHSSEP
AYIEEVNLIGDESNKFQELQTVSIKYRIRRTPQIGDKFSSRHGQKGVCSRKWPTIDMPFS
ETGIQPDIIINPHAFPSRMTIGMFVESLAGKAGALHGIAQDSTPWIFNEDDTPADYFGEQ
LAKAGYNYHGNEPMYSGATGEELRADIYVGVVYYQRLRHMVNDKFQVRSTGPVNSLTMQP
VKGRKR
Structures of the domain P22138 700-1065
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5w65 X-ray 4.3 B 700-1065 None
5w5y X-ray 3.8 B 700-1065 None
5w66 X-ray 3.9 B 700-1065 None
5m5x X-ray 4 B 700-1065 None
5m5y X-ray 4 B 700-1065 None
5w64 X-ray 4.2 B 700-1065  L-Bb 
5oa1 X-ray 4.4 B 700-1065  L-Bb 
5m3f X-ray 3.8 B 700-1065 None


© NPIDB team 2003 - 2019

text