Pfam domain
Pfam family: HTH_Crp_2 (PF13545.8)
Uniprot AC: P22262
RecName: Listeriolysin regulatory protein
Begin-End: 141-217
Organism: Listeria monocytogenes serovar 1/2a
Interaction Mode:  H-Bb H-Mj L-Bb L-Mj 

Sequence:
GSICGQLLILTYVYGKETPDGIKITLDNLTMQELGYSSGIAHSSAVSRIISKLKQEKVIV
YKNSCFYVQNLDYLKRY
Structures of the domain P22262 141-217
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5lek X-ray 2.8 A 141-217 None
5lek X-ray 2.8 B 141-217 None
5lrs X-ray 2.9 B 141-217 None
5lrs X-ray 2.9 A 141-217 None
6qwk X-ray 2.9 A 141-217  H-Bb H-Mj L-Bb L-Mj 
6qwk X-ray 2.9 B 141-217  H-Bb H-Mj L-Bb L-Mj 
5x6e X-ray 2.99 F 141-217  H-Bb H-Mj L-Bb L-Mj 
5x6e X-ray 2.99 E 141-217  H-Bb H-Mj L-Bb L-Mj 
5x6e X-ray 2.99 A 141-217  H-Bb H-Mj L-Bb L-Mj 
5x6e X-ray 2.99 B 141-217  H-Bb H-Mj L-Bb L-Mj 
5x6e X-ray 2.99 N 141-217  H-Bb H-Mj L-Bb L-Mj 
5x6e X-ray 2.99 M 141-217  H-Bb H-Mj L-Bb L-Mj 
5x6d X-ray 2.94 M 141-217  H-Bb H-Mj L-Bb L-Mj 
5x6d X-ray 2.94 N 141-217  H-Bb H-Mj L-Bb L-Mj 
5x6d X-ray 2.94 H 141-217  H-Bb H-Mj L-Bb L-Mj 
5x6d X-ray 2.94 G 141-217  H-Bb H-Mj L-Bb L-Mj 
5x6d X-ray 2.94 B 141-217  H-Bb H-Mj L-Bb L-Mj 
5x6d X-ray 2.94 A 141-217  H-Bb H-Mj L-Bb L-Mj 
6qwf X-ray 2.7 B 141-217  H-Bb H-Mj L-Bb L-Mj 
6qwf X-ray 2.7 A 141-217  H-Bb H-Mj L-Bb L-Mj 
5lej X-ray 2.7 B 141-217 None
5lej X-ray 2.7 A 141-217 None
6qwh X-ray 2.9 B 141-217  H-Bb H-Mj L-Bb L-Mj 
6qwh X-ray 2.9 A 141-217  H-Bb H-Mj L-Bb L-Mj 
6qwm X-ray 2.9 B 141-217  H-Bb H-Mj L-Bb L-Mj 
6qwm X-ray 2.9 A 141-217  H-Bb H-Mj L-Bb L-Mj 


© NPIDB team 2003 - 2021

text