Pfam domain
Pfam family: cNMP_binding (PF00027.31)
Uniprot AC: P22262
RecName: Listeriolysin regulatory protein
Begin-End: 19-109
Organism: Listeria monocytogenes serovar 1/2a
Interaction Mode:   

Sequence:
PKQFHKKELIFNQWDPQEYCIFLYDGITKLTSISENGTIMNLQYYKGAFVIMSGFIDTET
SVGYYNLEVISEQATAYVIKINELKELLSKN
Structures of the domain P22262 19-109
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5lek X-ray 2.8 A 19-109 None
5lek X-ray 2.8 B 19-109 None
5lrs X-ray 2.9 B 19-109 None
5lrs X-ray 2.9 A 19-109 None
5x6e X-ray 2.99 F 19-109 None
5x6e X-ray 2.99 E 19-109 None
5x6e X-ray 2.99 A 19-109 None
5x6e X-ray 2.99 B 19-109 None
5x6e X-ray 2.99 M 19-109 None
5x6e X-ray 2.99 N 19-109 None
5x6d X-ray 2.94 N 19-109 None
5x6d X-ray 2.94 M 19-109 None
5x6d X-ray 2.94 H 19-109 None
5x6d X-ray 2.94 G 19-109 None
5x6d X-ray 2.94 B 19-109 None
5x6d X-ray 2.94 A 19-109 None
5lej X-ray 2.7 A 19-109 None
5lej X-ray 2.7 B 19-109 None


© NPIDB team 2003 - 2021

text