Pfam domain
Pfam family: RNA_pol_Rpb2_3 (PF04565.15)
Uniprot AC: P22276
RecName: DNA-directed RNA polymerase III subunit RPC2
Begin-End: 456-520
Organism: Saccharomyces cerevisiae
Interaction Mode:  L-Bb 

Sequence:
HVLSRLSYISALGMMTRISSQFEKSRKVSGPRALQPSQFGMLCTADTPEGEACGLVKNLA
LMTHI
Structures of the domain P22276 456-520
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6f41 X-ray 4.3 B 457-520 None
6f44 X-ray 4.2 B 457-520 None
6eu0 X-ray 4 B 457-520  L-Bb 
6f40 X-ray 3.7 B 457-520 None
6eu1 X-ray 3.4 B 457-520 None
5fj8 X-ray 3.9 B 457-520 None
6f42 X-ray 5.5 B 457-520 None


© NPIDB team 2003 - 2020

text