Pfam domain
Pfam family: RNA_pol_Rpb2_1 (PF04563.14)
Uniprot AC: P22276
RecName: DNA-directed RNA polymerase III subunit RPC2
Begin-End: 56-431
Organism: Saccharomyces cerevisiae
Interaction Mode:  L-Bb 

Sequence:
GLVKQHLDSFNYFVDTDLKKIIKANQLILSDVDPEFYLKYVDIRVGKKSSSSTKDYLTPP
HECRLRDMTYSAPIYVDIEYTRGRNIIMHKDVEIGRMPIMLRSNKCILYDADESKMAKLN
ECPLDPGGYFIVNGTEKVILVQEQLSKNRIIVEADEKKGIVQASVTSSTHERKSKTYVIT
KNGKIYLKHNSIAEEIPIAIVLKACGILSDLEIMQLVCGNDSSYQDIFAVNLEESSKLDI
YTQQQALEYIGAKVKTMRRQKLTILQEGIEAIATTVIAHLTVEALDFREKALYIAMMTRR
VVMAMYNPKMIDDRDYVGNKRLELAGQLISLLFEDLFKKFNNDFKLSIDKVLKKPNRAME
YDALLSINVHSNNITS
Structures of the domain P22276 56-431
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6f41 X-ray 4.3 B 56-431 None
6f44 X-ray 4.2 B 56-431 None
6eu0 X-ray 4 B 56-431 None
6f40 X-ray 3.7 B 56-431 None
6eu1 X-ray 3.4 B 56-431 None
5fj8 X-ray 3.9 B 56-431 None
6f42 X-ray 5.5 B 56-431  L-Bb 


© NPIDB team 2003 - 2019

text