Pfam domain
Pfam family: Ribosomal_L10 (PF00466.19)
Uniprot AC: P22685
RecName: 60S acidic ribosomal protein P0
Begin-End: 4-105
Organism: Dictyostelium discoideum
Interaction Mode:   

Sequence:
AGSKRKNVFIEKATKLFTTYDKMIVAEADFVGSSQLQKIRKSIRGIGAVLMGKKTMIRKV
IRDLADSKPELDALNTYLKQNTCIIFCKDNIAEVKRVINTQR
Structures of the domain P22685 4-105
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5anb X-ray 4.1 C 6-103 None
5anc X-ray 4.2 C 6-103 None
5an9 X-ray 3.3 C 6-103 None


© NPIDB team 2003 - 2019

text