Pfam domain
Pfam family: zf-C4 (PF00105.17)
Uniprot AC: P22829
RecName: Nuclear receptor subfamily 4 group A member 1
Begin-End: 264-333
Organism: Rattus norvegicus
Interaction Mode:  H-Bb H-Mj S-Bb S-Mj L-Bb 

Sequence:
GRCAVCGDNASCQHYGVRTCEGCKGFFKRTVQKSAKYICLANKDCPVDKRRRNRCQFCRF
QKCLAVGMVK
Structures of the domain P22829 264-333
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
1cit X-ray 2.7 A 231-299  H-Bb H-Mj S-Bb S-Mj L-Bb 


© NPIDB team 2003 - 2019

text