Pfam domain
Pfam family: TFIIS_M (PF07500.13)
Uniprot AC: P23193
RecName: Transcription elongation factor A protein 1
Begin-End: 138-248
Organism: Homo sapiens
Interaction Mode:   

Sequence:
DSVRLKCREMLAAALRTGDDYIAIGADEEELGSQIEEAIYQEIRNTDMKYKNRVRSRISN
LKDAKNPNLRKNVLCGNIPPDLFARMTAEEMASDELKEMRKNLTKEAIREH
Structures of the domain P23193 138-248
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5iy7 X-ray 8.6 U 138-248 None
5iya X-ray 5.4 U 138-248 None
5iy8 X-ray 7.9 U 138-248 None
5iy6 X-ray 7.2 U 138-248 None
5iyc X-ray 3.9 U 138-248 None
5iyb X-ray 3.9 U 138-248 None


© NPIDB team 2003 - 2019

text