Pfam domain
Pfam family: Ribosomal_L35p (PF01632.18)
Uniprot AC: P23326
RecName: 50S ribosomal protein L35, chloroplastic
Begin-End: 90-150
Organism: Spinacia oleracea
Interaction Mode:   

Sequence:
YKMKTHKASAKRFRVTGKGKIVRRRAGKQHLLAKKNTKRKNRLSKLIQVDRSDYDNVIGA
L
Structures of the domain P23326 90-150
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5x8t X-ray 3.3 4 90-146 None
5h1s X-ray 3.5 e 90-146 None
5mlc X-ray 3.9 5 90-146 None
5mmi X-ray 3.25 4 90-146 None


© NPIDB team 2003 - 2019

text