Pfam domain
Pfam family: tRNA-synt_1b (PF00579.24)
Uniprot AC: P23381
RecName: Tryptophan--tRNA ligase, cytoplasmic
Begin-End: 151-443
Organism: Homo sapiens
Interaction Mode:   

Sequence:
ENKKPFYLYTGRGPSSEAMHVGHLIPFIFTKWLQDVFNVPLVIQMTDDEKYLWKDLTLDQ
AYSYAVENAKDIIACGFDINKTFIFSDLDYMGMSSGFYKNVVKIQKHVTFNQVKGIFGFT
DSDCIGKISFPAIQAAPSFSNSFPQIFRDRTDIQCLIPCAIDQDPYFRMTRDVAPRIGYP
KPALLHSTFFPALQGAQTKMSASDPNSSIFLTDTAKQIKTKVNKHAFSGGRDTIEEHRQF
GGNCDVDVSFMYLTFFLEDDDKLEQIRKDYTSGAMLTGELKKALIEVLQPLIA
Structures of the domain P23381 151-443
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
2azx X-ray 2.8 B 152-438 None
2azx X-ray 2.8 A 152-438 None
2dr2 X-ray 3 A 152-439 None
2ake X-ray 3.1 A 152-439 None


© NPIDB team 2003 - 2020

text